- Recombinant Drosophila melanogaster Protein cornichon (cni)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1000157
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 16,931 Da
- E Coli or Yeast
- Protein cornichon (cni)
- 1-144
- cornichon
- Dmel\CG5855, anon-35Fe, BG:DS02740.13, IV, spnG, CG5855, Cni
Sequence
MAFNFTAFTYIVALIGDAFLIFFAIFHVIAFDELKTDYKNPIDQCNSLNPLVLPEYLLHIFLNLLFLFCGEWFSLCINIPLIAYHIWRYKNRPVMSGPGLYDPTTVLKTDTLYRNMREGWIKLAVYLISFFYYIYGMVYSLIST